Lineage for d4r4ud1 (4r4u D:4-115)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551736Species Yersinia pestis [TaxId:632] [257672] (3 PDB entries)
  8. 2551751Domain d4r4ud1: 4r4u D:4-115 [271485]
    automated match to d1c8ua1
    complexed with coa, mla, na

Details for d4r4ud1

PDB Entry: 4r4u (more details), 2.2 Å

PDB Description: crystal structure of acyl-coa thioesterase tesb from yersinia pestis in complex with coenzyme a
PDB Compounds: (D:) acyl-coa thioesterase II

SCOPe Domain Sequences for d4r4ud1:

Sequence, based on SEQRES records: (download)

>d4r4ud1 d.38.1.0 (D:4-115) automated matches {Yersinia pestis [TaxId: 632]}
aleklldlldlekieegifrgqsedlglrqvfggqvvgqaiyaakqtvpaertvhsfhsy
flrpgdsskpiiydvetlrdgnsfsarrvsaiqngkpifymtasfqsqeegf

Sequence, based on observed residues (ATOM records): (download)

>d4r4ud1 d.38.1.0 (D:4-115) automated matches {Yersinia pestis [TaxId: 632]}
aleklldlldlekieegifrgqserqvfggqvvgqaiyaakqtvpaertvhsfhsyflrp
gdsskpiiydvetlrdgnsfsarrvsaiqngkpifymtasfqsqeegf

SCOPe Domain Coordinates for d4r4ud1:

Click to download the PDB-style file with coordinates for d4r4ud1.
(The format of our PDB-style files is described here.)

Timeline for d4r4ud1: