SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4qq2c_ (4qq2 C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041369Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2041370Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2041661Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2041662Protein automated matches [190873] (4 species)
    not a true protein
  7. 2041716Species Mouse (Mus musculus) [TaxId:10090] [271469] (7 PDB entries)
  8. 2041722Domain d4qq2c_: 4qq2 C: [271481]
    automated match to d2ka3a_
    complexed with cd

Details for d4qq2c_

PDB Entry: 4qq2 (more details), 1.8 Å

PDB Description: crystal structure of c1ql1
PDB Compounds: (C:) c1q-related factor

SCOPe Domain Sequences for d4qq2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qq2c_ b.22.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rvafyaglknphegyevlkfddvvtnlgnnydaasgkftcnipgtyfftyhvlmrggdgt
smwadlckngqvrasaiaqdadqnydyasnsvilhldagdevfikldggkahggnsnkys
tfsgfiiysd

SCOPe Domain Coordinates for d4qq2c_:

Click to download the PDB-style file with coordinates for d4qq2c_.
(The format of our PDB-style files is described here.)

Timeline for d4qq2c_: