Lineage for d1bbpb_ (1bbp B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16457Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins)
  6. 16472Protein Bilin-binding protein [50837] (1 species)
  7. 16473Species Cabbage butterfly (Pieris brassicae) [TaxId:7116] [50838] (1 PDB entry)
  8. 16475Domain d1bbpb_: 1bbp B: [27148]

Details for d1bbpb_

PDB Entry: 1bbp (more details), 2 Å

PDB Description: molecular structure of the bilin binding protein (bbp) from pieris brassicae after refinement at 2.0 angstroms resolution.

SCOP Domain Sequences for d1bbpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbpb_ b.60.1.1 (B:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae)}
nvyhdgacpevkpvdnfdwsnyhgkwwevakypnsvekygkcgwaeytpegksvkvsnyh
vihgkeyfiegtaypvgdskigkiyhkltyggvtkenvfnvlstdnknyiigyyckyded
kkghqdfvwvlsrskvltgeaktavenyligspvvdsqklvysdfseaackvn

SCOP Domain Coordinates for d1bbpb_:

Click to download the PDB-style file with coordinates for d1bbpb_.
(The format of our PDB-style files is described here.)

Timeline for d1bbpb_: