![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
![]() | Protein automated matches [190873] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [271469] (9 PDB entries) |
![]() | Domain d4qqha_: 4qqh A: [271479] automated match to d2ka3a_ complexed with cd |
PDB Entry: 4qqh (more details), 1.2 Å
SCOPe Domain Sequences for d4qqha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qqha_ b.22.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt smwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnkys tfsgfiiyad
Timeline for d4qqha_: