Lineage for d4qqha_ (4qqh A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777665Species Mouse (Mus musculus) [TaxId:10090] [271469] (9 PDB entries)
  8. 2777666Domain d4qqha_: 4qqh A: [271479]
    automated match to d2ka3a_
    complexed with cd

Details for d4qqha_

PDB Entry: 4qqh (more details), 1.2 Å

PDB Description: crystal structure of c1ql3 in space group h32
PDB Compounds: (A:) Complement C1q-like protein 3

SCOPe Domain Sequences for d4qqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qqha_ b.22.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
smwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
tfsgfiiyad

SCOPe Domain Coordinates for d4qqha_:

Click to download the PDB-style file with coordinates for d4qqha_.
(The format of our PDB-style files is described here.)

Timeline for d4qqha_: