| Class b: All beta proteins [48724] (180 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
| Protein automated matches [190873] (4 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [271469] (9 PDB entries) |
| Domain d4qq2a_: 4qq2 A: [271478] automated match to d2ka3a_ complexed with cd |
PDB Entry: 4qq2 (more details), 1.8 Å
SCOPe Domain Sequences for d4qq2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qq2a_ b.22.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvafyaglknphegyevlkfddvvtnlgnnydaasgkftcnipgtyfftyhvlmrggdg
tsmwadlckngqvrasaiaqdadqnydyasnsvilhldagdevfikldggkahggnsnky
stfsgfiiysd
Timeline for d4qq2a_: