SCOPe 2.08: Domain d4pljl1: 4plj L:1-107

Lineage for d4pljl1 (4plj L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4pljl1: 4plj L:1-107 [271460]
   Other proteins in same PDB: d4pljc2, d4pljd_, d4pljh_, d4pljl2
   automated match to d2fd6l1

Details for d4pljl1

PDB Entry: 4plj, 2.3 Å

PDB Description: hepatitis e virus e2s domain (genotype iv) in complex with a neutralizing antibody 8g12

PDB Compounds: (L:) 8G12 light chain

SCOPe Domain Sequences for d4pljl1:

Sequence; same for both SEQRES and ATOM records:

>d4pljl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslsvsvgetvtitcraseniysnlvwyqqkqgkspqvlvyaatnlpdgvps
rfsgsgsgtqyslkinslqsedsgsyycqhfwetpftfgsgtkleik

Timeline for d4pljl1:

• d4pljl1 first appeared in SCOPe 2.05
  
• d4pljl1 appears in SCOPe 2.07