SCOPe 2.05: Domain d4qjpb_: 4qjp B:

Lineage for d4qjpb_ (4qjp B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (18 PDB entries)

8. Domain d4qjpb_: 4qjp B: [271452]
   automated match to d3d0na_
   complexed with cit, edo, peg, v1f, zn

Details for d4qjpb_

PDB Entry: 4qjp, 1.62 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme xiii with inhibitor

PDB Compounds: (B:) Carbonic anhydrase 13

SCOPe Domain Sequences for d4qjpb_:

Sequence; same for both SEQRES and ATOM records:

>d4qjpb_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
nhrppqplkgrkvrasfh

Timeline for d4qjpb_:

• d4qjpb_ is new in SCOPe 2.05-stable
  
• d4qjpb_ appears in SCOPe 2.06
  
• d4qjpb_ appears in the current release, SCOPe 2.08