SCOPe 2.05: Domain d1dfvb_: 1dfv B:

Lineage for d1dfvb_ (1dfv B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (34 PDB entries)

8. Domain d1dfvb_: 1dfv B: [27145]
   complexed with ndg, so4

Details for d1dfvb_

PDB Entry: 1dfv, 2.6 Å

PDB Description: crystal structure of human neutrophil gelatinase associated lipocalin monomer

PDB Compounds: (B:) human neutrophil gelatinase

SCOPe Domain Sequences for d1dfvb_:

Sequence; same for both SEQRES and ATOM records:

>d1dfvb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgcqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d1dfvb_:

• d1dfvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dfvb_ appears in SCOPe 2.04
  
• d1dfvb_ appears in SCOPe 2.06
  
• d1dfvb_ appears in the current release, SCOPe 2.08