Lineage for d1dfvb_ (1dfv B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232449Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 232450Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
    bind hydrophobic ligands in their interior
  5. 232451Family b.60.1.1: Retinol binding protein-like [50815] (16 proteins)
    barrel, closed; n=8, S=12, meander
  6. 232527Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 232528Species Human (Homo sapiens) [TaxId:9606] [50836] (3 PDB entries)
  8. 232531Domain d1dfvb_: 1dfv B: [27145]
    complexed with nag, so4

Details for d1dfvb_

PDB Entry: 1dfv (more details), 2.6 Å

PDB Description: crystal structure of human neutrophil gelatinase associated lipocalin monomer

SCOP Domain Sequences for d1dfvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfvb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens)}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgcqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

SCOP Domain Coordinates for d1dfvb_:

Click to download the PDB-style file with coordinates for d1dfvb_.
(The format of our PDB-style files is described here.)

Timeline for d1dfvb_: