SCOP 1.65: Domain d1dfva_: 1dfv A:

Lineage for d1dfva_ (1dfv A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (3 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (17 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (4 PDB entries)

8. Domain d1dfva_: 1dfv A: [27144]

Details for d1dfva_

PDB Entry: 1dfv, 2.6 Å

PDB Description: crystal structure of human neutrophil gelatinase associated lipocalin monomer

SCOP Domain Sequences for d1dfva_:

Sequence; same for both SEQRES and ATOM records:

>d1dfva_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens)}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgcqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d1dfva_:

• d1dfva_ first appeared (with stable ids) in SCOP 1.55
  
• d1dfva_ appears in SCOP 1.63
  
• d1dfva_ appears in SCOP 1.67
  
• d1dfva_ appears in the current release, SCOPe 2.08