Class b: All beta proteins [48724] (176 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) automatically mapped to Pfam PF00194 |
Protein automated matches [190681] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187805] (18 PDB entries) |
Domain d4qjxa_: 4qjx A: [271439] automated match to d3d0na_ complexed with edo, peg, wwo, zn |
PDB Entry: 4qjx (more details)
SCOPe Domain Sequences for d4qjxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qjxa_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs nhrppqplkgrkvrasfh
Timeline for d4qjxa_: