SCOP 1.73: Domain d1qqsa_: 1qqs A:

Lineage for d1qqsa_ (1qqs A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (8 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (7 PDB entries)

8. Domain d1qqsa_: 1qqs A: [27143]
   complexed with man, nag, non

Details for d1qqsa_

PDB Entry: 1qqs, 2.4 Å

PDB Description: neutrophil gelatinase associated lipocalin homodimer

PDB Compounds: (A:) neutrophil gelatinase

SCOP Domain Sequences for d1qqsa_:

Sequence; same for both SEQRES and ATOM records:

>d1qqsa_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyeekedas
ynvtsvlfrkkkcdyairtfvpgcqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselknnfirfskslglpenhivfpvpidqcid

Timeline for d1qqsa_:

• d1qqsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qqsa_ appears in SCOP 1.71
  
• d1qqsa_ appears in SCOP 1.75
  
• d1qqsa_ appears in the current release, SCOPe 2.08