Lineage for d4qdqa1 (4qdq A:276-433)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2370433Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2370434Protein automated matches [190770] (38 species)
    not a true protein
  7. 2370641Species Human (Homo sapiens) [TaxId:9606] [188939] (20 PDB entries)
  8. 2370653Domain d4qdqa1: 4qdq A:276-433 [271425]
    Other proteins in same PDB: d4qdqa3, d4qdqb3
    automated match to d2qqja1
    complexed with gol, so4

Details for d4qdqa1

PDB Entry: 4qdq (more details), 1.95 Å

PDB Description: physical basis for nrp2 ligand binding
PDB Compounds: (A:) Neuropilin-2

SCOPe Domain Sequences for d4qdqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qdqa1 b.18.1.0 (A:276-433) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcnvplgmesgrianeqisasstysdgrwtpqqsrlhgddngwtpnldsnkeylqvdlrf
ltmltaiatqgaisretqngyyvksyklevstngedwmvyrhgknhkvfqanndatevvl
nklhaplltrfvrirpqtwhsgialrlelfgcrvtdap

SCOPe Domain Coordinates for d4qdqa1:

Click to download the PDB-style file with coordinates for d4qdqa1.
(The format of our PDB-style files is described here.)

Timeline for d4qdqa1: