Lineage for d4qdqb2 (4qdq B:434-595)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775243Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)
  8. 2775271Domain d4qdqb2: 4qdq B:434-595 [271424]
    Other proteins in same PDB: d4qdqa3, d4qdqb3
    automated match to d2qqja2
    complexed with gol, so4

Details for d4qdqb2

PDB Entry: 4qdq (more details), 1.95 Å

PDB Description: physical basis for nrp2 ligand binding
PDB Compounds: (B:) Neuropilin-2

SCOPe Domain Sequences for d4qdqb2:

Sequence, based on SEQRES records: (download)

>d4qdqb2 b.18.1.0 (B:434-595) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csnmlgmlsgliadsqisasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlg
tpktvkgviiqgarggdsitavearafvrkfkvsyslngkdweyiqdprtqqpklfegnm
hydtpdirrfdpipaqyvrvyperwspagigmrlevlgcdwt

Sequence, based on observed residues (ATOM records): (download)

>d4qdqb2 b.18.1.0 (B:434-595) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csnmlgmlsgliadsqisasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlg
tpktvkgviiqgararafvrkfkvsyslngkdweyiqdprtqqpklfegnmhydtpdirr
fdpipaqyvrvyperwspagigmrlevlgcdwt

SCOPe Domain Coordinates for d4qdqb2:

Click to download the PDB-style file with coordinates for d4qdqb2.
(The format of our PDB-style files is described here.)

Timeline for d4qdqb2: