Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries) |
Domain d4qdqb2: 4qdq B:434-595 [271424] Other proteins in same PDB: d4qdqa3, d4qdqb3 automated match to d2qqja2 complexed with gol, so4 |
PDB Entry: 4qdq (more details), 1.95 Å
SCOPe Domain Sequences for d4qdqb2:
Sequence, based on SEQRES records: (download)
>d4qdqb2 b.18.1.0 (B:434-595) automated matches {Human (Homo sapiens) [TaxId: 9606]} csnmlgmlsgliadsqisasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlg tpktvkgviiqgarggdsitavearafvrkfkvsyslngkdweyiqdprtqqpklfegnm hydtpdirrfdpipaqyvrvyperwspagigmrlevlgcdwt
>d4qdqb2 b.18.1.0 (B:434-595) automated matches {Human (Homo sapiens) [TaxId: 9606]} csnmlgmlsgliadsqisasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlg tpktvkgviiqgararafvrkfkvsyslngkdweyiqdprtqqpklfegnmhydtpdirr fdpipaqyvrvyperwspagigmrlevlgcdwt
Timeline for d4qdqb2: