Lineage for d4qdra2 (4qdr A:434-594)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775243Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)
  8. 2775306Domain d4qdra2: 4qdr A:434-594 [271423]
    Other proteins in same PDB: d4qdra3
    automated match to d2qqja2

Details for d4qdra2

PDB Entry: 4qdr (more details), 2.4 Å

PDB Description: physical basis for nrp2 ligand binding
PDB Compounds: (A:) Neuropilin-2

SCOPe Domain Sequences for d4qdra2:

Sequence, based on SEQRES records: (download)

>d4qdra2 b.18.1.0 (A:434-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csnmlgmlsgliadsqisasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlg
tpktvkgviiqgarggdsitavearafvrkfkvsyslngkdweyiqdprtqqpklfegnm
hydtpdirrfdpipaqyvrvyperwspagigmrlevlgcdw

Sequence, based on observed residues (ATOM records): (download)

>d4qdra2 b.18.1.0 (A:434-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csnmlgmlsgliadsqisasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlg
tpktvkgviiqgargearafvrkfkvsyslngkdweyiqdprtqqpklfegnmhydtpdi
rrfdpipaqyvrvyperwspagigmrlevlgcdw

SCOPe Domain Coordinates for d4qdra2:

Click to download the PDB-style file with coordinates for d4qdra2.
(The format of our PDB-style files is described here.)

Timeline for d4qdra2: