Lineage for d4qdra1 (4qdr A:274-433)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777799Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1777800Protein automated matches [190770] (31 species)
    not a true protein
  7. 1777966Species Human (Homo sapiens) [TaxId:9606] [188939] (14 PDB entries)
  8. 1778013Domain d4qdra1: 4qdr A:274-433 [271422]
    automated match to d2qqja1

Details for d4qdra1

PDB Entry: 4qdr (more details), 2.4 Å

PDB Description: physical basis for nrp2 ligand binding
PDB Compounds: (A:) Neuropilin-2

SCOPe Domain Sequences for d4qdra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qdra1 b.18.1.0 (A:274-433) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmqcnvplgmesgrianeqisasstysdgrwtpqqsrlhgddngwrpnldsnkeylqvdl
rfltmltaiatqgaisretqngyyvksyklevstngedwmvyrhgknhkvfqanndatev
vlnklhaplltrfvrirpqtwhsgialrlelfgcrvtdap

SCOPe Domain Coordinates for d4qdra1:

Click to download the PDB-style file with coordinates for d4qdra1.
(The format of our PDB-style files is described here.)

Timeline for d4qdra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qdra2