Lineage for d2a2gd_ (2a2g D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804418Protein Major urinary protein/alpha-2u-globulin [50832] (2 species)
  7. 2804439Species Norway rat (Rattus norvegicus) [TaxId:10116] [50834] (2 PDB entries)
  8. 2804443Domain d2a2gd_: 2a2g D: [27142]
    complexed with leo

Details for d2a2gd_

PDB Entry: 2a2g (more details), 2.9 Å

PDB Description: the crystal structures of a2u-globulin and its complex with a hyaline droplet inducer.
PDB Compounds: (D:) protein (alpha-2u-globulin)

SCOPe Domain Sequences for d2a2gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2gd_ b.60.1.1 (D:) Major urinary protein/alpha-2u-globulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eeasstrgnldvaklngdwfsivvasnkrekieengsmrvfmqhidvlenslgfkfrike
ngecrelylvayktpedgeyfveydggntftilktdydryvmfhlinfkngetfqlmvly
grtkdlssdikekfaklceahgitrdniidltktdrcl

SCOPe Domain Coordinates for d2a2gd_:

Click to download the PDB-style file with coordinates for d2a2gd_.
(The format of our PDB-style files is described here.)

Timeline for d2a2gd_: