![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
![]() | Protein automated matches [190420] (9 species) not a true protein |
![]() | Species Castor bean (Ricinus communis) [TaxId:3988] [188830] (15 PDB entries) |
![]() | Domain d4q2va_: 4q2v A: [271418] automated match to d4hv3a_ complexed with 0xe |
PDB Entry: 4q2v (more details), 2.2 Å
SCOPe Domain Sequences for d4q2va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q2va_ d.165.1.1 (A:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]} qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd vsilipiialmvyrcappp
Timeline for d4q2va_: