Lineage for d4pvxf_ (4pvx F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731438Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 2731503Protein automated matches [190489] (5 species)
    not a true protein
  7. 2731504Species Human (Homo sapiens) [TaxId:9606] [187688] (85 PDB entries)
  8. 2731556Domain d4pvxf_: 4pvx F: [271411]
    automated match to d4demf_
    complexed with gol, mg, ys1

Details for d4pvxf_

PDB Entry: 4pvx (more details), 2.18 Å

PDB Description: crystal structure of human fpps in complex with [({4-[4- (cyclopropyloxy)phenyl]pyridin-2-yl}amino)methanediyl]bis(phosphonic acid)
PDB Compounds: (F:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4pvxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pvxf_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiyk

SCOPe Domain Coordinates for d4pvxf_:

Click to download the PDB-style file with coordinates for d4pvxf_.
(The format of our PDB-style files is described here.)

Timeline for d4pvxf_: