SCOPe 2.06: Domain d4pvyf_: 4pvy F:

Lineage for d4pvyf_ (4pvy F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein automated matches [190489] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187688] (78 PDB entries)

8. Domain d4pvyf_: 4pvy F: [271410]
   automated match to d4demf_
   complexed with gol, jd1, mg

Details for d4pvyf_

PDB Entry: 4pvy, 2.05 Å

PDB Description: crystal structure of human fpps in complex with [({5-[4-(propan-2- yloxy)phenyl]pyridin-3-yl}amino)methanediyl]bis(phosphonic acid)

PDB Compounds: (F:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4pvyf_:

Sequence; same for both SEQRES and ATOM records:

>d4pvyf_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiykrrk

Timeline for d4pvyf_:

• d4pvyf_ first appeared in SCOPe 2.05
  
• d4pvyf_ appears in SCOPe 2.07
  
• d4pvyf_ appears in the current release, SCOPe 2.08