Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Major urinary protein/alpha-2u-globulin [50832] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [50834] (2 PDB entries) |
Domain d2a2gc_: 2a2g C: [27141] complexed with leo |
PDB Entry: 2a2g (more details), 2.9 Å
SCOPe Domain Sequences for d2a2gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a2gc_ b.60.1.1 (C:) Major urinary protein/alpha-2u-globulin {Norway rat (Rattus norvegicus) [TaxId: 10116]} eeasstrgnldvaklngdwfsivvasnkrekieengsmrvfmqhidvlenslgfkfrike ngecrelylvayktpedgeyfveydggntftilktdydryvmfhlinfkngetfqlmvly grtkdlssdikekfaklceahgitrdniidltktdrcl
Timeline for d2a2gc_: