Lineage for d4p14a_ (4p14 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778280Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2778281Species Brazilian jackbean (Canavalia brasiliensis) [TaxId:61861] [49903] (7 PDB entries)
  8. 2778286Domain d4p14a_: 4p14 A: [271409]
    automated match to d1azda_
    complexed with ade, ca, dbb, edo, gol, mn

Details for d4p14a_

PDB Entry: 4p14 (more details), 2 Å

PDB Description: crystal structure of canavalia brasiliensis (conbr) complexed with adenine
PDB Compounds: (A:) Concanavalin-Br

SCOPe Domain Sequences for d4p14a_:

Sequence, based on SEQRES records: (download)

>d4p14a_ b.29.1.1 (A:) Concanavalin A {Brazilian jackbean (Canavalia brasiliensis) [TaxId: 61861]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d4p14a_ b.29.1.1 (A:) Concanavalin A {Brazilian jackbean (Canavalia brasiliensis) [TaxId: 61861]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsh
etnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvhi
wessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d4p14a_:

Click to download the PDB-style file with coordinates for d4p14a_.
(The format of our PDB-style files is described here.)

Timeline for d4p14a_: