Lineage for d4omjb2 (4omj B:76-274)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111988Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2111989Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) (S)
    automatically mapped to Pfam PF00650
  5. 2111990Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins)
    Pfam PF00650
  6. 2112008Protein automated matches [233926] (2 species)
    not a true protein
  7. 2112009Species Human (Homo sapiens) [TaxId:9606] [271398] (2 PDB entries)
  8. 2112011Domain d4omjb2: 4omj B:76-274 [271404]
    Other proteins in same PDB: d4omja1, d4omjb1
    automated match to d1olma3
    complexed with 2tx, cl, so4

Details for d4omjb2

PDB Entry: 4omj (more details), 1.6 Å

PDB Description: crystal structure of spf bound to 2,3-oxidosqualene
PDB Compounds: (B:) sec14-like protein 2

SCOPe Domain Sequences for d4omjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4omjb2 c.13.1.1 (B:76-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppeviqqylsggmcgydldgcpvwydiigpldakgllfsaskqdllrtkmrecelllqec
ahqttklgrkvetitiiydceglglkhlwkpaveaygeflcmfeenypetlkrlfvvkap
klfpvaynlikpflsedtrkkimvlganwkevllkhispdqvpveyggtmtdpdgnpkck
skinyggdiprkyyvrdqv

SCOPe Domain Coordinates for d4omjb2:

Click to download the PDB-style file with coordinates for d4omjb2.
(The format of our PDB-style files is described here.)

Timeline for d4omjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4omjb1