SCOPe 2.08: Domain d4omjb2: 4omj B:76-274

Lineage for d4omjb2 (4omj B:76-274)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families)
   automatically mapped to Pfam PF00650

5. Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins)
   Pfam PF00650

6. Protein automated matches [233926] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [271398] (2 PDB entries)

8. Domain d4omjb2: 4omj B:76-274 [271404]
   Other proteins in same PDB: d4omja1, d4omjb1
   automated match to d1olma3
   complexed with 2tx, cl, so4

Details for d4omjb2

PDB Entry: 4omj, 1.6 Å

PDB Description: crystal structure of spf bound to 2,3-oxidosqualene

PDB Compounds: (B:) sec14-like protein 2

SCOPe Domain Sequences for d4omjb2:

Sequence; same for both SEQRES and ATOM records:

>d4omjb2 c.13.1.1 (B:76-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppeviqqylsggmcgydldgcpvwydiigpldakgllfsaskqdllrtkmrecelllqec
ahqttklgrkvetitiiydceglglkhlwkpaveaygeflcmfeenypetlkrlfvvkap
klfpvaynlikpflsedtrkkimvlganwkevllkhispdqvpveyggtmtdpdgnpkck
skinyggdiprkyyvrdqv

Timeline for d4omjb2:

• d4omjb2 first appeared in SCOPe 2.05
  
• d4omjb2 appears in SCOPe 2.07