Lineage for d4omka2 (4omk A:76-274)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460484Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2460485Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) (S)
    automatically mapped to Pfam PF00650
  5. 2460486Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins)
    Pfam PF00650
  6. 2460504Protein automated matches [233926] (3 species)
    not a true protein
  7. 2460505Species Human (Homo sapiens) [TaxId:9606] [271398] (2 PDB entries)
  8. 2460508Domain d4omka2: 4omk A:76-274 [271402]
    Other proteins in same PDB: d4omka1, d4omkb1
    automated match to d1olma3
    complexed with cl, ipa, so4, sql

Details for d4omka2

PDB Entry: 4omk (more details), 1.75 Å

PDB Description: crystal structure of spf bound to squalene
PDB Compounds: (A:) sec14-like protein 2

SCOPe Domain Sequences for d4omka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4omka2 c.13.1.1 (A:76-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppeviqqylsggmcgydldgcpvwydiigpldakgllfsaskqdllrtkmrecelllqec
ahqttklgrkvetitiiydceglglkhlwkpaveaygeflcmfeenypetlkrlfvvkap
klfpvaynlikpflsedtrkkimvlganwkevllkhispdqvpveyggtmtdpdgnpkck
skinyggdiprkyyvrdqv

SCOPe Domain Coordinates for d4omka2:

Click to download the PDB-style file with coordinates for d4omka2.
(The format of our PDB-style files is described here.)

Timeline for d4omka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4omka1