| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) ![]() |
| Family a.5.3.0: automated matches [227224] (1 protein) not a true family |
| Protein automated matches [226965] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [258515] (4 PDB entries) |
| Domain d4omjb1: 4omj B:1-75 [271400] Other proteins in same PDB: d4omja2, d4omjb2 automated match to d1olma1 complexed with 2tx, cl, so4 |
PDB Entry: 4omj (more details), 1.6 Å
SCOPe Domain Sequences for d4omjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4omjb1 a.5.3.0 (B:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msgrvgdlsprqkealakfrenvqdvlpalpnpddyfllrwlrarsfdlqkseamlrkhv
efrkqkdidniiswq
Timeline for d4omjb1: