![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
![]() | Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) ![]() automatically mapped to Pfam PF00650 |
![]() | Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins) Pfam PF00650 |
![]() | Protein automated matches [233926] (2 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [271398] (2 PDB entries) |
![]() | Domain d4omja2: 4omj A:76-274 [271399] Other proteins in same PDB: d4omja1, d4omjb1 automated match to d1olma3 complexed with 2tx, cl, so4 |
PDB Entry: 4omj (more details), 1.6 Å
SCOPe Domain Sequences for d4omja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4omja2 c.13.1.1 (A:76-274) automated matches {Homo sapiens [TaxId: 9606]} ppeviqqylsggmcgydldgcpvwydiigpldakgllfsaskqdllrtkmrecelllqec ahqttklgrkvetitiiydceglglkhlwkpaveaygeflcmfeenypetlkrlfvvkap klfpvaynlikpflsedtrkkimvlganwkevllkhispdqvpveyggtmtdpdgnpkck skinyggdiprkyyvrdqv
Timeline for d4omja2: