SCOPe 2.06: Domain d4o9ha_: 4o9h A:

Lineage for d4o9ha_ (4o9h A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Interleukin-6 [47272] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47273] (9 PDB entries)

8. Domain d4o9ha_: 4o9h A: [271394]
   Other proteins in same PDB: d4o9hl1, d4o9hl2
   automated match to d1alua_

Details for d4o9ha_

PDB Entry: 4o9h, 2.42 Å

PDB Description: structure of interleukin-6 in complex with a camelid fab fragment

PDB Compounds: (A:) interleukin-6

SCOPe Domain Sequences for d4o9ha_:

Sequence, based on SEQRES records:

>d4o9ha_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records):

>d4o9ha_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
ltsseridkqiryildgisalrketcnksnnlnlpkmaekdgcfqsgfneetclvkiitg
llefevyleylqnrsseeqaravqmstkvliqflqkkaknldaittpdpttnaslltklq
aqnqwlqdmtthlilrsfkeflqsslralrqm

Timeline for d4o9ha_:

• d4o9ha_ first appeared in SCOPe 2.05
  
• d4o9ha_ appears in SCOPe 2.07
  
• d4o9ha_ appears in the current release, SCOPe 2.08