SCOPe 2.08: Domain d4z2xa_: 4z2x A:

Lineage for d4z2xa_ (4z2x A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Splicing factor U2AF 65 KDa subunit [54936] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [256391] (2 PDB entries)

8. Domain d4z2xa_: 4z2x A: [271387]
   automated match to d2m52a_

Details for d4z2xa_

PDB Entry: 4z2x, 2.15 Å

PDB Description: crystal structure of a rna binding domain of a u2 small nuclear ribonucleoprotein auxiliary factor 2 (u2af) from mouse at 2.15 a resolution

PDB Compounds: (A:) splicing factor u2af 65 kda subunit

SCOPe Domain Sequences for d4z2xa_:

Sequence; same for both SEQRES and ATOM records:

>d4z2xa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Mouse (Mus musculus) [TaxId: 10090]}
ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk
ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw

Timeline for d4z2xa_:

• d4z2xa_ first appeared in SCOPe 2.05
  
• d4z2xa_ appears in SCOPe 2.07