Lineage for d4ywec_ (4ywe C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2157920Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2157921Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2158358Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2158359Protein automated matches [190683] (49 species)
    not a true protein
  7. 2158463Species Burkholderia cenocepacia [TaxId:216591] [236250] (5 PDB entries)
  8. 2158484Domain d4ywec_: 4ywe C: [271384]
    automated match to d4cbba_
    complexed with ca, edo, mg

Details for d4ywec_

PDB Entry: 4ywe (more details), 2.15 Å

PDB Description: crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
PDB Compounds: (C:) Putative aldehyde dehydrogenase

SCOPe Domain Sequences for d4ywec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ywec_ c.82.1.0 (C:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
akhfiagewtlpaqletipvvdpsdgqpfatiargtapdieravaaardafagpwgaasa
aergrvlmrlsarvtdsieelaaieardtgkplkqaradaaalaryfefyagaadklhge
tlpyqagytvltvrephgvtghivpwnypmqifgrsvgaalaagnacvvkpaedaclsvl
rvaelaaeaglpagalnivtgygheagaalarhpgidhisftgspatgklvtqmaaenhv
pvtlelggkspqivfadadldaalpvlvsaivqnggqtcsagsrvlieravyeplverla
tafnglrvgpsradldcgplinakqqqrvwdflsdaqhdgipmaahgqvvadapesgfyq
apallrdvppshrlaqeevfgpvlaamrfvdedeavalangtpyglvagiwtrdgarqmr
larrlragqvfinnygagggvelpfggvghsghgrekgfealygftalktiairhg

SCOPe Domain Coordinates for d4ywec_:

Click to download the PDB-style file with coordinates for d4ywec_.
(The format of our PDB-style files is described here.)

Timeline for d4ywec_: