Lineage for d4ywed_ (4ywe D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909125Species Burkholderia cenocepacia [TaxId:216591] [236250] (5 PDB entries)
  8. 2909147Domain d4ywed_: 4ywe D: [271379]
    automated match to d4cbba_
    complexed with ca, edo, mg

Details for d4ywed_

PDB Entry: 4ywe (more details), 2.15 Å

PDB Description: crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
PDB Compounds: (D:) Putative aldehyde dehydrogenase

SCOPe Domain Sequences for d4ywed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ywed_ c.82.1.0 (D:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
akhfiagewtlpaqletipvvdpsdgqpfatiargtapdieravaaardafagpwgaasa
aergrvlmrlsarvtdsieelaaieardtgkplkqaradaaalaryfefyagaadklhge
tlpyqagytvltvrephgvtghivpwnypmqifgrsvgaalaagnacvvkpaedaclsvl
rvaelaaeaglpagalnivtgygheagaalarhpgidhisftgspatgklvtqmaaenhv
pvtlelggkspqivfadadldaalpvlvsaivqnggqtcsagsrvlieravyeplverla
tafnglrvgpsradldcgplinakqqqrvwdflsdaqhdgipmaahgqvvadapesgfyq
apallrdvppshrlaqeevfgpvlaamrfvdedeavalangtpyglvagiwtrdgarqmr
larrlragqvfinnygagggvelpfggvghsghgrekgfealygftalktiairhg

SCOPe Domain Coordinates for d4ywed_:

Click to download the PDB-style file with coordinates for d4ywed_.
(The format of our PDB-style files is described here.)

Timeline for d4ywed_: