Lineage for d4y8dc1 (4y8d C:6-120)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (155 PDB entries)
  8. 2347793Domain d4y8dc1: 4y8d C:6-120 [271374]
    Other proteins in same PDB: d4y8dc2, d4y8dd2
    automated match to d1ieha_
    complexed with 49j, edo

Details for d4y8dc1

PDB Entry: 4y8d (more details), 2.1 Å

PDB Description: crystal structure of cyclin-g associated kinase (gak) complexed with selective 12i inhibitor
PDB Compounds: (C:) Nanobody

SCOPe Domain Sequences for d4y8dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y8dc1 b.1.1.1 (C:6-120) automated matches {Llama (Lama glama) [TaxId: 9844]}
esgggsvqaggslrlscgaseytsrmgwfrqapgaeregvacihrqsnlsyysdsvrgrf
tisqdnakttafllmsslkpedtaiyycatttdcaafverataitagqgtqvtvs

SCOPe Domain Coordinates for d4y8dc1:

Click to download the PDB-style file with coordinates for d4y8dc1.
(The format of our PDB-style files is described here.)

Timeline for d4y8dc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4y8dc2