Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (140 species) not a true protein |
Species Escherichia coli [TaxId:83333] [271371] (2 PDB entries) |
Domain d4yahx1: 4yah X:29-271 [271372] Other proteins in same PDB: d4yahx2 automated match to d4ib2a_ complexed with met |
PDB Entry: 4yah (more details), 1.6 Å
SCOPe Domain Sequences for d4yahx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yahx1 c.94.1.0 (X:29-271) automated matches {Escherichia coli [TaxId: 83333]} dpnhikvgvivgaeqqvaevaqkvakdkygldvelvtfndyvlpnealskgdidanafqh kpyldqqlkdrgyklvavgntfvypiagyskkiksldelqdgsqvavpndptnlgrslll lqkvgliklkdgvgllptvldvvenpknlkiveleapqlprslddaqialavinttyasq igltpakdgifvedkespyvnlivtrednkdaenvkkfvqayqsdevyeaankvfnggav kgw
Timeline for d4yahx1: