SCOPe 2.06: Domain d4yahx1: 4yah X:29-271

Lineage for d4yahx1 (4yah X:29-271)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [271371] (2 PDB entries)

8. Domain d4yahx1: 4yah X:29-271 [271372]
   Other proteins in same PDB: d4yahx2
   automated match to d4ib2a_
   complexed with met

Details for d4yahx1

PDB Entry: 4yah, 1.6 Å

PDB Description: crystal structure of the methionine binding protein, metq

PDB Compounds: (X:) D-methionine-binding lipoprotein MetQ

SCOPe Domain Sequences for d4yahx1:

Sequence; same for both SEQRES and ATOM records:

>d4yahx1 c.94.1.0 (X:29-271) automated matches {Escherichia coli [TaxId: 83333]}
dpnhikvgvivgaeqqvaevaqkvakdkygldvelvtfndyvlpnealskgdidanafqh
kpyldqqlkdrgyklvavgntfvypiagyskkiksldelqdgsqvavpndptnlgrslll
lqkvgliklkdgvgllptvldvvenpknlkiveleapqlprslddaqialavinttyasq
igltpakdgifvedkespyvnlivtrednkdaenvkkfvqayqsdevyeaankvfnggav
kgw

Timeline for d4yahx1:

• d4yahx1 first appeared in SCOPe 2.05, called d4yahx_
  
• d4yahx1 appears in SCOPe 2.07
  
• d4yahx1 appears in the current release, SCOPe 2.08