SCOPe 2.06: Domain d4y42j2: 4y42 J:87-156

Lineage for d4y42j2 (4y42 J:87-156)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
   intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta

4. Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families)
   automatically mapped to Pfam PF02560

5. Family d.72.1.0: automated matches [271343] (1 protein)
   not a true family

6. Protein automated matches [271344] (1 species)
   not a true protein

7. Species Serratia proteamaculans [TaxId:399741] [271345] (2 PDB entries)

8. Domain d4y42j2: 4y42 J:87-156 [271370]
   Other proteins in same PDB: d4y42a1, d4y42b1, d4y42c1, d4y42d1, d4y42e1, d4y42f1, d4y42g1, d4y42h1, d4y42i1, d4y42j1
   automated match to d1dwka2
   complexed with gol

Details for d4y42j2

PDB Entry: 4y42, 2.09 Å

PDB Description: cyanase (cyns) from serratia proteamaculans

PDB Compounds: (J:) cyanate hydratase

SCOPe Domain Sequences for d4y42j2:

Sequence; same for both SEQRES and ATOM records:

>d4y42j2 d.72.1.0 (J:87-156) automated matches {Serratia proteamaculans [TaxId: 399741]}
gvptdptiyrfyemvqiygstlkalvheqfgdgiisainfkldikkvpdpdggeravitl
dgkylptkpf

Timeline for d4y42j2:

• d4y42j2 first appeared in SCOPe 2.05
  
• d4y42j2 appears in SCOPe 2.07
  
• d4y42j2 appears in the current release, SCOPe 2.08