Lineage for d4y42i2 (4y42 I:87-156)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957542Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 2957543Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) (S)
    automatically mapped to Pfam PF02560
  5. 2957629Family d.72.1.0: automated matches [271343] (1 protein)
    not a true family
  6. 2957630Protein automated matches [271344] (3 species)
    not a true protein
  7. 2957642Species Serratia proteamaculans [TaxId:399741] [271345] (2 PDB entries)
  8. 2957656Domain d4y42i2: 4y42 I:87-156 [271368]
    Other proteins in same PDB: d4y42a1, d4y42b1, d4y42c1, d4y42d1, d4y42e1, d4y42f1, d4y42g1, d4y42h1, d4y42i1, d4y42j1
    automated match to d1dwka2
    complexed with gol

Details for d4y42i2

PDB Entry: 4y42 (more details), 2.09 Å

PDB Description: cyanase (cyns) from serratia proteamaculans
PDB Compounds: (I:) cyanate hydratase

SCOPe Domain Sequences for d4y42i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y42i2 d.72.1.0 (I:87-156) automated matches {Serratia proteamaculans [TaxId: 399741]}
gvptdptiyrfyemvqiygstlkalvheqfgdgiisainfkldikkvpdpdggeravitl
dgkylptkpf

SCOPe Domain Coordinates for d4y42i2:

Click to download the PDB-style file with coordinates for d4y42i2.
(The format of our PDB-style files is described here.)

Timeline for d4y42i2: