Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily) intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta |
Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) automatically mapped to Pfam PF02560 |
Family d.72.1.0: automated matches [271343] (1 protein) not a true family |
Protein automated matches [271344] (1 species) not a true protein |
Species Serratia proteamaculans [TaxId:399741] [271345] (1 PDB entry) |
Domain d4y42d2: 4y42 D:87-156 [271354] Other proteins in same PDB: d4y42a1, d4y42b1, d4y42c1, d4y42d1, d4y42e1, d4y42f1, d4y42g1, d4y42h1, d4y42i1, d4y42j1 automated match to d1dwka2 complexed with gol |
PDB Entry: 4y42 (more details), 2.09 Å
SCOPe Domain Sequences for d4y42d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y42d2 d.72.1.0 (D:87-156) automated matches {Serratia proteamaculans [TaxId: 399741]} gvptdptiyrfyemvqiygstlkalvheqfgdgiisainfkldikkvpdpdggeravitl dgkylptkpf
Timeline for d4y42d2: