Lineage for d4y0gb1 (4y0g B:75-156)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765993Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
    lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)
  6. 2765998Protein 5'-AMP-activated protein kinase subunit beta-2 [158887] (2 species)
  7. 2766001Species Norway rat (Rattus norvegicus) [TaxId:10116] [255461] (4 PDB entries)
  8. 2766003Domain d4y0gb1: 4y0g B:75-156 [271339]
    Other proteins in same PDB: d4y0gb2
    automated match to d2f15a1
    complexed with gol

Details for d4y0gb1

PDB Entry: 4y0g (more details), 1.6 Å

PDB Description: beta2 carbohydrate binding module (cbm) of amp-activated protein kinase (ampk)
PDB Compounds: (B:) 5'-amp-activated protein kinase subunit beta-2

SCOPe Domain Sequences for d4y0gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y0gb1 b.1.18.21 (B:75-156) 5'-AMP-activated protein kinase subunit beta-2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqwv
hdpsepvvtsqlgtinnlihvk

SCOPe Domain Coordinates for d4y0gb1:

Click to download the PDB-style file with coordinates for d4y0gb1.
(The format of our PDB-style files is described here.)

Timeline for d4y0gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4y0gb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4y0ga_