![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins) lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G) |
![]() | Protein 5'-AMP-activated protein kinase subunit beta-2 [158887] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [255461] (4 PDB entries) |
![]() | Domain d4y0ga_: 4y0g A: [271338] Other proteins in same PDB: d4y0gb2 automated match to d2f15a1 complexed with gol |
PDB Entry: 4y0g (more details), 1.6 Å
SCOPe Domain Sequences for d4y0ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y0ga_ b.1.18.21 (A:) 5'-AMP-activated protein kinase subunit beta-2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} qarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqwv hdpsepvvtsqlgtinnlihvk
Timeline for d4y0ga_: