Lineage for d1i04a_ (1i04 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2071991Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2072134Protein Major urinary protein/alpha-2u-globulin [50832] (2 species)
  7. 2072135Species Mouse (Mus musculus) [TaxId:10090] [50833] (19 PDB entries)
  8. 2072152Domain d1i04a_: 1i04 A: [27132]

Details for d1i04a_

PDB Entry: 1i04 (more details), 2 Å

PDB Description: crystal structure of mouse major urinary protein-i from mouse liver
PDB Compounds: (A:) major urinary protein I

SCOPe Domain Sequences for d1i04a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i04a_ b.60.1.1 (A:) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlenslvlkfhtvr
deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly
grepdlssdikerfaqlceehgilreniidlsnanrclq

SCOPe Domain Coordinates for d1i04a_:

Click to download the PDB-style file with coordinates for d1i04a_.
(The format of our PDB-style files is described here.)

Timeline for d1i04a_: