Lineage for d3wucb_ (3wuc B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1782197Species Xenopus laevis [TaxId:8355] [271304] (2 PDB entries)
  8. 1782199Domain d3wucb_: 3wuc B: [271308]
    automated match to d3i8ta_
    complexed with mla

Details for d3wucb_

PDB Entry: 3wuc (more details), 1.6 Å

PDB Description: x-ray crystal structure of xenopus laevis galectin-va
PDB Compounds: (B:) galectin

SCOPe Domain Sequences for d3wucb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wucb_ b.29.1.0 (B:) automated matches {Xenopus laevis [TaxId: 8355]}
gsmdmepdvritnlnlhkghrvevrgriakgtnrfavdlgtdsrnlichcnprfeysvdk
ntivlnskqndvwdiekketafpfksgsetmlifdfedcitvhlpdgkeipftcrfpiev
inylalnnielisisvh

SCOPe Domain Coordinates for d3wucb_:

Click to download the PDB-style file with coordinates for d3wucb_.
(The format of our PDB-style files is described here.)

Timeline for d3wucb_:

  • d3wucb_ appears in periodic updates to SCOPe 2.05 starting on 2015-04-08
  • d3wucb_ is called d3wucb1 in SCOPe 2.06
  • d3wucb_ appears in the current release, SCOPe 2.07, called d3wucb1