SCOPe 2.08: Domain d3wucb1: 3wuc B:1-135

Lineage for d3wucb1 (3wuc B:1-135)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [271304] (2 PDB entries)

8. Domain d3wucb1: 3wuc B:1-135 [271308]
   Other proteins in same PDB: d3wucb2
   automated match to d3i8ta_
   complexed with mla

Details for d3wucb1

PDB Entry: 3wuc, 1.6 Å

PDB Description: x-ray crystal structure of xenopus laevis galectin-va

PDB Compounds: (B:) galectin

SCOPe Domain Sequences for d3wucb1:

Sequence; same for both SEQRES and ATOM records:

>d3wucb1 b.29.1.0 (B:1-135) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mdmepdvritnlnlhkghrvevrgriakgtnrfavdlgtdsrnlichcnprfeysvdknt
ivlnskqndvwdiekketafpfksgsetmlifdfedcitvhlpdgkeipftcrfpievin
ylalnnielisisvh

Timeline for d3wucb1:

• d3wucb1 first appeared in SCOPe 2.05, called d3wucb_
  
• d3wucb1 appears in SCOPe 2.07