Lineage for d3wuca_ (3wuc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780623Species African clawed frog (Xenopus laevis) [TaxId:8355] [271304] (2 PDB entries)
  8. 2780624Domain d3wuca_: 3wuc A: [271305]
    Other proteins in same PDB: d3wucb2
    automated match to d3i8ta_
    complexed with mla

Details for d3wuca_

PDB Entry: 3wuc (more details), 1.6 Å

PDB Description: x-ray crystal structure of xenopus laevis galectin-va
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d3wuca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wuca_ b.29.1.0 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mdmepdvritnlnlhkghrvevrgriakgtnrfavdlgtdsrnlichcnprfeysvdknt
ivlnskqndvwdiekketafpfksgsetmlifdfedcitvhlpdgkeipftcrfpievin
ylalnnielisisvh

SCOPe Domain Coordinates for d3wuca_:

Click to download the PDB-style file with coordinates for d3wuca_.
(The format of our PDB-style files is described here.)

Timeline for d3wuca_: