| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [271304] (2 PDB entries) |
| Domain d3wuca_: 3wuc A: [271305] Other proteins in same PDB: d3wucb2 automated match to d3i8ta_ complexed with mla |
PDB Entry: 3wuc (more details), 1.6 Å
SCOPe Domain Sequences for d3wuca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wuca_ b.29.1.0 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mdmepdvritnlnlhkghrvevrgriakgtnrfavdlgtdsrnlichcnprfeysvdknt
ivlnskqndvwdiekketafpfksgsetmlifdfedcitvhlpdgkeipftcrfpievin
ylalnnielisisvh
Timeline for d3wuca_: