Lineage for d4wuba1 (4wub A:4-220)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974033Species Escherichia coli [TaxId:83333] [271298] (26 PDB entries)
  8. 2974038Domain d4wuba1: 4wub A:4-220 [271302]
    Other proteins in same PDB: d4wuba2
    automated match to d4prxa1
    complexed with anp, cl, k, mg, na

Details for d4wuba1

PDB Entry: 4wub (more details), 1.75 Å

PDB Description: n-terminal 43 kda fragment of the e. coli dna gyrase b subunit grown from 100 mm kcl condition
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4wuba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wuba1 d.122.1.0 (A:4-220) automated matches {Escherichia coli [TaxId: 83333]}
sydsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivti
hadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvv
nalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefe
yeilakrlrelsflnsgvsirlrdkrdgkedhfhyeg

SCOPe Domain Coordinates for d4wuba1:

Click to download the PDB-style file with coordinates for d4wuba1.
(The format of our PDB-style files is described here.)

Timeline for d4wuba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wuba2