Lineage for d1vyaj_ (1vya J:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907823Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1908322Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 1908323Protein automated matches [191087] (10 species)
    not a true protein
  7. 1908425Species Zea mays [TaxId:4577] [271285] (1 PDB entry)
  8. 1908435Domain d1vyaj_: 1vya J: [271295]
    automated match to d1nhkr_

Details for d1vyaj_

PDB Entry: 1vya (more details), 2.05 Å

PDB Description: identification and characterization of the first plant g-quadruplex binding protein encoded by the zea mays l. nucleoside diphosphate1 gene, zmndpk1
PDB Compounds: (J:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1vyaj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vyaj_ d.58.6.0 (J:) automated matches {Zea mays [TaxId: 4577]}
mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
esankeialwfpegladwqssqhpwiyek

SCOPe Domain Coordinates for d1vyaj_:

Click to download the PDB-style file with coordinates for d1vyaj_.
(The format of our PDB-style files is described here.)

Timeline for d1vyaj_: