| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
| Protein automated matches [191087] (19 species) not a true protein |
| Species Maize (Zea mays) [TaxId:4577] [271285] (1 PDB entry) |
| Domain d1vyah_: 1vya H: [271292] automated match to d1nhkr_ |
PDB Entry: 1vya (more details), 2.05 Å
SCOPe Domain Sequences for d1vyah_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vyah_ d.58.6.0 (H:) automated matches {Maize (Zea mays) [TaxId: 4577]}
mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
esankeialwfpegladwqssqhpwiyek
Timeline for d1vyah_: