Lineage for d1vyah_ (1vya H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951787Species Maize (Zea mays) [TaxId:4577] [271285] (1 PDB entry)
  8. 2951795Domain d1vyah_: 1vya H: [271292]
    automated match to d1nhkr_

Details for d1vyah_

PDB Entry: 1vya (more details), 2.05 Å

PDB Description: identification and characterization of the first plant g-quadruplex binding protein encoded by the zea mays l. nucleoside diphosphate1 gene, zmndpk1
PDB Compounds: (H:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1vyah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vyah_ d.58.6.0 (H:) automated matches {Maize (Zea mays) [TaxId: 4577]}
mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
esankeialwfpegladwqssqhpwiyek

SCOPe Domain Coordinates for d1vyah_:

Click to download the PDB-style file with coordinates for d1vyah_.
(The format of our PDB-style files is described here.)

Timeline for d1vyah_: