Lineage for d4v38a_ (4v38 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1876907Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 1876908Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (13 families) (S)
  5. 1877318Family c.87.1.9: Sialyltransferase-like [142773] (2 proteins)
    automatically mapped to Pfam PF11477
  6. 1877335Protein automated matches [190544] (2 species)
    not a true protein
  7. 1877336Species Pasteurella dagmatis [TaxId:754] [271272] (5 PDB entries)
  8. 1877338Domain d4v38a_: 4v38 A: [271282]
    automated match to d2iy7a_

Details for d4v38a_

PDB Entry: 4v38 (more details), 1.96 Å

PDB Description: apo-structure of alpha2,3-sialyltransferase variant 1 from pasteurella dagmatis
PDB Compounds: (A:) sialyltransferase

SCOPe Domain Sequences for d4v38a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v38a_ c.87.1.9 (A:) automated matches {Pasteurella dagmatis [TaxId: 754]}
sktitiyldhaslptlnqlmhftkesedketarifgfsrfklpekiteqynnihfveikn
nrptediftildqypekleldlhlniahsiqlfhpilqyrfkhpdrisikslnlyddgtm
eyvdlekeenkdiksaikkaekqlsdylltgkinfdnptlaryvwqsqypvkyhflstey
fekaeflqplktylagkyqkmdwsayeklspeqqtfylklvgfsdetkqlfhteqtkfif
tgtttwegntdireyyakqqlnllkhfthsegdlfigdqykiyfkghprggdindyilkh
akditnipanisfeilmmtgllpdkvggvasslyfslpkekishiiftsnkkiknkedal
ndpyvrvmlrlgmidksqiifwdslkql

SCOPe Domain Coordinates for d4v38a_:

Click to download the PDB-style file with coordinates for d4v38a_.
(The format of our PDB-style files is described here.)

Timeline for d4v38a_: