Lineage for d4v38a1 (4v38 A:2-385)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2910964Family c.87.1.9: Sialyltransferase-like [142773] (2 proteins)
    automatically mapped to Pfam PF11477
  6. 2910981Protein automated matches [190544] (2 species)
    not a true protein
  7. 2910982Species Pasteurella dagmatis [TaxId:754] [271272] (5 PDB entries)
  8. 2910984Domain d4v38a1: 4v38 A:2-385 [271282]
    Other proteins in same PDB: d4v38a2
    automated match to d2iy7a_

Details for d4v38a1

PDB Entry: 4v38 (more details), 1.96 Å

PDB Description: apo-structure of alpha2,3-sialyltransferase variant 1 from pasteurella dagmatis
PDB Compounds: (A:) sialyltransferase

SCOPe Domain Sequences for d4v38a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v38a1 c.87.1.9 (A:2-385) automated matches {Pasteurella dagmatis [TaxId: 754]}
tiyldhaslptlnqlmhftkesedketarifgfsrfklpekiteqynnihfveiknnrpt
ediftildqypekleldlhlniahsiqlfhpilqyrfkhpdrisikslnlyddgtmeyvd
lekeenkdiksaikkaekqlsdylltgkinfdnptlaryvwqsqypvkyhflsteyfeka
eflqplktylagkyqkmdwsayeklspeqqtfylklvgfsdetkqlfhteqtkfiftgtt
twegntdireyyakqqlnllkhfthsegdlfigdqykiyfkghprggdindyilkhakdi
tnipanisfeilmmtgllpdkvggvasslyfslpkekishiiftsnkkiknkedalndpy
vrvmlrlgmidksqiifwdslkql

SCOPe Domain Coordinates for d4v38a1:

Click to download the PDB-style file with coordinates for d4v38a1.
(The format of our PDB-style files is described here.)

Timeline for d4v38a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4v38a2