SCOPe 2.08: Domain d4v3la_: 4v3l A:

Lineage for d4v3la_ (4v3l A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)

8. Domain d4v3la_: 4v3l A: [271281]
   Other proteins in same PDB: d4v3lb1, d4v3lb2, d4v3ld1, d4v3ld2
   automated match to d3a33a_
   complexed with edo, zn

Details for d4v3la_

PDB Entry: 4v3l, 1.53 Å

PDB Description: rnf38-ub-ubch5b-ub complex

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d4v3la_:

Sequence; same for both SEQRES and ATOM records:

>d4v3la_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsikldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

Timeline for d4v3la_:

• d4v3la_ first appeared in SCOPe 2.05
  
• d4v3la_ appears in SCOPe 2.07