SCOPe 2.07: Domain d4v3ca1: 4v3c A:2-385

Lineage for d4v3ca1 (4v3c A:2-385)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.9: Sialyltransferase-like [142773] (2 protein domains)
   automatically mapped to Pfam PF11477

6. Protein automated matches [190544] (2 species)
   not a true protein

7. Species Pasteurella dagmatis [TaxId:754] [271272] (5 PDB entries)

8. Domain d4v3ca1: 4v3c A:2-385 [271280]
   Other proteins in same PDB: d4v3ca2
   automated match to d2iy7a_
   complexed with c

Details for d4v3ca1

PDB Entry: 4v3c, 1.84 Å

PDB Description: the structure of alpha2,3-sialyltransferase variant 2 from pasteurella dagmatis in complex with the donor product cmp

PDB Compounds: (A:) sialyltransferase

SCOPe Domain Sequences for d4v3ca1:

Sequence; same for both SEQRES and ATOM records:

>d4v3ca1 c.87.1.9 (A:2-385) automated matches {Pasteurella dagmatis [TaxId: 754]}
tiyldhaslptlnqlmhftkesedketarifgfsrfklpekiteqynnihfveiknnrpt
ediftildqypekleldlhlniahsiqlfhpilqyrfkhpdrisikslnlyddgtaeyvd
lekeenkdiksaikkaekqlsdylltgkinfdnptlaryvwqsqypvkyhflsteyfeka
eflqplktylagkyqkmdwsayeklspeqqtfylklvgfsdetkqlfhteqtkfiftgtt
twegntdireyyakqqlnllkhfthsegdlfigdqykiyfkghprggdindyilkhakdi
tnipanisfeilmmtgllpdkvggvasslyfslpkekishiiftsnkkiknkedalndpy
vrvmlrlgmidksqiifwdslkql

Timeline for d4v3ca1:

• d4v3ca1 first appeared in SCOPe 2.05, called d4v3ca_
  
• d4v3ca1 appears in SCOPe 2.06