SCOPe 2.05: Domain d4v3ba_: 4v3b A:

Lineage for d4v3ba_ (4v3b A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (13 families)

5. Family c.87.1.9: Sialyltransferase-like [142773] (2 proteins)
   automatically mapped to Pfam PF11477

6. Protein automated matches [190544] (2 species)
   not a true protein

7. Species Pasteurella dagmatis [TaxId:754] [271272] (5 PDB entries)

8. Domain d4v3ba_: 4v3b A: [271278]
   automated match to d2iy7a_
   complexed with c

Details for d4v3ba_

PDB Entry: 4v3b, 2.18 Å

PDB Description: the structure of alpha2,3-sialyltransferase variant 1 from pasteurella dagmatis in complex with the donor product cmp

PDB Compounds: (A:) sialyltransferase

SCOPe Domain Sequences for d4v3ba_:

Sequence; same for both SEQRES and ATOM records:

>d4v3ba_ c.87.1.9 (A:) automated matches {Pasteurella dagmatis [TaxId: 754]}
sktitiyldhaslptlnqlmhftkesedketarifgfsrfklpekiteqynnihfveikn
nrptediftildqypekleldlhlniahsiqlfhpilqyrfkhpdrisikslnlyddgtm
eyvdlekeenkdiksaikkaekqlsdylltgkinfdnptlaryvwqsqypvkyhflstey
fekaeflqplktylagkyqkmdwsayeklspeqqtfylklvgfsdetkqlfhteqtkfif
tgtttwegntdireyyakqqlnllkhfthsegdlfigdqykiyfkghprggdindyilkh
akditnipanisfeilmmtgllpdkvggvasslyfslpkekishiiftsnkkiknkedal
ndpyvrvmlrlgmidksqiifwdslkql

Timeline for d4v3ba_:

• d4v3ba_ is new in SCOPe 2.05-stable
  
• d4v3ba_ is called d4v3ba1 in SCOPe 2.06
  
• d4v3ba_ appears in the current release, SCOPe 2.08, called d4v3ba1